PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G180700.1
Common NamePHAVU_006G180700g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family VOZ
Protein Properties Length: 473aa    MW: 52476.4 Da    PI: 6.3935
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G180700.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ435.29.1e-1341984151217
                 VOZ   1 pppsaflgpkcalwdctrpaqgsewlqdycssfhatlalneglpgttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwn 91 
                         pppsaflgpkcalwdc+rp+qg +w+qdycssfha+lalneg+pg+tpvlrp+gi+lkd+llf+alsak+qgk vgipecegaatakspwn
  Phvul.006G180700.1 198 PPPSAFLGPKCALWDCPRPVQGLDWCQDYCSSFHAALALNEGPPGMTPVLRPGGIGLKDNLLFSALSAKAQGKVVGIPECEGAATAKSPWN 288
                         89***************************************************************************************** PP

                 VOZ  92 aaelfdlsllegetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalal 182
                         a+elfd+++legetirewlffdkprrafesgnrkqrslpdysgrgwhesrkqvm+efgglkrsyymdpqp++ fewhlyeyei+++da+al
  Phvul.006G180700.1 289 APELFDICVLEGETIREWLFFDKPRRAFESGNRKQRSLPDYSGRGWHESRKQVMNEFGGLKRSYYMDPQPLNLFEWHLYEYEISKCDACAL 379
                         ******************************************************************************************* PP

                 VOZ 183 yrlelklvdekksakgk.vskdsladlqkklgrlta 217
                         yrlelklvd+kks+k++ ++ ds+adlqk++g+l+a
  Phvul.006G180700.1 380 YRLELKLVDGKKSSKARiITGDSVADLQKHMGSLSA 415
                         ****************95578************987 PP

Sequence ? help Back to Top
Protein Sequence    Length: 473 aa     Download sequence    Send to blast
MKKISKSTCK SASHRLFKDK ARNHVDDLQV MFLDLQFARK ESRTIDVALL EEQVHQMLRE  60
WKAELNEPSP ASSLQQGGSL GSFSTDVYRL LQLCEEEDDA TSPLVAPKPE PNDQTMQAGA  120
RVIVQEGQHE QEFLLLKECK HSAIGVPNMP AHNLDGPALE FHQLEFNKDF DHSFYGGTGF  180
CEEGGGPHIS SYLPSVCPPP SAFLGPKCAL WDCPRPVQGL DWCQDYCSSF HAALALNEGP  240
PGMTPVLRPG GIGLKDNLLF SALSAKAQGK VVGIPECEGA ATAKSPWNAP ELFDICVLEG  300
ETIREWLFFD KPRRAFESGN RKQRSLPDYS GRGWHESRKQ VMNEFGGLKR SYYMDPQPLN  360
LFEWHLYEYE ISKCDACALY RLELKLVDGK KSSKARIITG DSVADLQKHM GSLSAEFHSD  420
SNKRSAKGSR TKLGIGGGVY SASNRVALLN APYQYGLTAP YDFVADNTRD YM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007148099.10.0hypothetical protein PHAVU_006G180700g
SwissprotQ9SGQ00.0VOZ1_ARATH; Transcription factor VOZ1
TrEMBLV7BSU10.0V7BSU1_PHAVU; Uncharacterized protein
STRINGGLYMA10G07940.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.20.0vascular plant one zinc finger protein